SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33416620|gb|AAH55957| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33416620|gb|AAH55957|
Domain Number 1 Region: 255-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000663
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 
Weak hits

Sequence:  gi|33416620|gb|AAH55957|
Domain Number - Region: 327-372
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.034
Family N-terminal coiled coil domain from apc 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33416620|gb|AAH55957|
Sequence length 376
Comment MGC68423 protein [Xenopus laevis]
Sequence
MEVLAKKMAMVKCSGQIVKCMQGSPDPWAKAQDYVARAIHDKSLSKSKGKGALVYAACWI
AEQYKNLSVQKGNLEEKVHCLNLLVDSLKFSVENAAAINASNQRTTAKYKQVCIENEQLK
QRLRDAESLVATFRKAGADHSNCKSELKQLKAQLVARDCVVSAVKVENTAKNDRNVTDVK
CIKDSNMNCELAVKSKMLNEDCYRQAKPPIATLKCTENRTVGQKQDVRKVQFYKPVQHRK
QPGCERVFAIKATYPEKQSVYSTDKKCTQKKVFRCYACSRVGHIARNCTMQFYNTNNHKN
VYNGNGSWKSSRWGFQNKSKSWNTWIPYHVLKTQNERLSEENSSLKNVWGKFNNELESLK
IEISQMKRTKDDVNRC
Download sequence
Identical sequences Q7T106
gi|33416620|gb|AAH55957|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]