SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34016817|gb|AAQ56584| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34016817|gb|AAQ56584|
Domain Number 1 Region: 110-198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000795
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 22-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000223
Family I set domains 0.014
Further Details:      
 
Weak hits

Sequence:  gi|34016817|gb|AAQ56584|
Domain Number - Region: 195-240
Classification Level Classification E-value
Superfamily Gated mechanosensitive channel 0.051
Family Gated mechanosensitive channel 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|34016817|gb|AAQ56584|
Sequence length 272
Comment type I TM-receptor XFL1.1b [Xenopus laevis]
Sequence
YQCQTLTSDKSEPVRLQVAHSWLTLKVPMFVFEGDELYVSCAGYPGYSARDAVLYKDNEV
IGSSPSDADFLVGRANMTTSGLYRCTRQVKDGLIYYSYASEEQIAVKELFSKPVMKVNPN
HPTEGDHMTITCDTKLSPHRETTELQFVFYRNGHNVQGFSLSNQYGVPSAQLEHSGNYTC
EVRTNNNTVRKTSDEISVQMAERSYTSLGVGITIALLIFFLVVALLVYVFKNTTFILRHT
YPTASVESTGNRKGLNFKYIEVYQAQKEEICV
Download sequence
Identical sequences Q4VWU6
gi|34016817|gb|AAQ56584|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]