SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46249470|gb|AAH68655| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46249470|gb|AAH68655|
Domain Number 1 Region: 275-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000341
Further Details:      
 
Domain Number 2 Region: 432-594
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.03e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000131
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-35
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 4 Region: 148-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-34
Family Spermadhesin, CUB domain 0.0000193
Further Details:      
 
Domain Number 5 Region: 638-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-29
Family MAM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46249470|gb|AAH68655|
Sequence length 913
Comment MGC81032 protein [Xenopus laevis]
Sequence
MDVFALLLGLISLCSLGAKVSGQEGSVCGGRLNAKDAGYITSPGYPNDYPPHQNCEWIIS
APEPNQKIVLNFNPHFDIEKHDCKYDFIEIRDGDSESAELLGKHCGNIAPSTITSSGSQM
YIRFTSDYARQGAGFSLRYEIFKTGSEDCSRNFTNSNGTIESPGFPDKYPHNLDCVFTIV
AKPKMEIILQFHTFDLEHDPLQVGEGDCKYDWLDIWDGVPSVGPLIGRYCGTKTPSEIRS
STGILSLTFHTDMAVAKDGFSARYYLAPQEVPETFQCNVPLGMESGRISNEQITASSTYS
DGRWTAQQSRLNSDDNGWTPNVDTNREYLQIDLRFLFLLTAVATQGAISRETQTPYYVKS
YKLEVSTNGEDWMMFRHGKNHKIFQGNTDPTEVVLNKIPQPVLARFIRFRPQTWDTGIAM
RVELYGCQITDSPCSNMLGMMSGLISDSQITASSTREYLWSSGVARLVSSRSGWYTHISP
GQIGKEWLQVDLGTVKTVRGVIIQGARGGDSLPTTENRAFVRKFKVAHSLNGNDWEYILD
SKTEQAKQFEGNMHYDTPEVRRFEPVAAQFVRVYPERWSPAGMGMRMEVLGCDRQEAKPT
TETVKPTIKTEEVTTQNMSDEETTECGEACVDEFQYPPGFNCNFDHSDDVCSWTHDTNAD
FTWSFHPHSPWMGHSGSIAGNSKHYLRLPSSGRREGQHARLLSPKMYLPRTVICMVFRYR
ASGSSGGTLQVLRKSTQENRLLWKMKEEQESDWREGRIILNSSKGEEEYQVVIEGIVGKG
QPGEIAVDDIRIAADIPVEHCMEPLTAFPRQNPLFPPGGTLLPGSEPTVDTVSVQPIPVY
WYYVIAAGGAVLVLVSVALALVLHYHRFRYAAKKSDPAITYKTSHYTNGAPLTVEPTLTI
KLEQDDRDHSSPC
Download sequence
Identical sequences Q6NUE0
gi|147904234|ref|NP_001084707| gi|46249470|gb|AAH68655| NP_001084707.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]