SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46329897|gb|AAH68854| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46329897|gb|AAH68854|
Domain Number 1 Region: 64-190
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.12e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000654
Family Glutathione S-transferase (GST), N-terminal domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46329897|gb|AAH68854|
Sequence length 195
Comment Unknown (protein for IMAGE:3399306) [Xenopus laevis]
Sequence
irllladqgiswkedevqipdwfsgkdarkkeavfgqlpqfqdgdyvlyqsnsilrylgn
khgltgandeerghidmvndgvedlrqkygrliffeyetgkdkylkelpsqldfferils
knangskfvvgqkisfadynlldilqchldlcskslsayplltayverlvarpkiseylk
sdarnrrpitpkhkk
Download sequence
Identical sequences gi|46329897|gb|AAH68854|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]