SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49256569|gb|AAH71064| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|49256569|gb|AAH71064|
Domain Number - Region: 39-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0157
Family Glutathione peroxidase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49256569|gb|AAH71064|
Sequence length 72
Comment MGC78876 protein [Xenopus laevis]
Sequence
MGVKFRGLLMLPCILAAFIHAQTDVDQKSVDCYSSADGSIYDYGATTLDGSQFIPFKAYQ
GKYLLFVNVATF
Download sequence
Identical sequences Q6GR65
gi|49256569|gb|AAH71064|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]