SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49257852|gb|AAH74258| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49257852|gb|AAH74258|
Domain Number 1 Region: 287-407,458-481
Classification Level Classification E-value
Superfamily TPR-like 2.87e-27
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 2 Region: 210-325
Classification Level Classification E-value
Superfamily TPR-like 7.94e-24
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  gi|49257852|gb|AAH74258|
Domain Number - Region: 100-145
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.017
Family N-terminal coiled coil domain from apc 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|49257852|gb|AAH74258|
Sequence length 540
Comment Unknown (protein for MGC:84013) [Xenopus laevis]
Sequence
MSVMMYPREEKLDKLSQEEIISNTKLVMQGLEALRNEHNSILHSLLETIKCLKKDEEANL
VHEKSSLLRKSVEMIELGLGEAQLMMALSNHLTAVESEKQKLRAQVRRLCQENQWLRDEL
ANTQQKLQHSEQNVAQLEEEKKHLEFMNQLKKYDEDVSPTEEKEGDSAKDNLDELFPNEE
DDSGQGIPHQHGSAAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDL
EKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGKDHPAVAATLNNL
AVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYC
RALEIYQARLGPDDPNVAKTKNNLASCYLKQGKYKAAEQLYKDILTQAHVKEFGSVDDDH
KPIWMHAEEREEMSKTPHNDSTPYSEYGGWYKACRVNSPTVNTTLRNLGALYRRQGKLEA
AETLEECAQRSRRQGLDPANQTKVAQLLKEGDTPEQRRKGRETPRSSVKYESGTEGGEEA
Download sequence
Identical sequences Q6GM31
gi|49257852|gb|AAH74258|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]