SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51258465|gb|AAH80099| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51258465|gb|AAH80099|
Domain Number 1 Region: 105-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-16
Family C1 set domains (antibody constant domain-like) 0.054
Further Details:      
 
Domain Number 2 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family V set domains (antibody variable domain-like) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51258465|gb|AAH80099|
Sequence length 308
Comment MGC84341 protein [Xenopus laevis]
Sequence
MAALCLLLLLSLAEAIDLRVPELPVIGLLDKDVILPCWFTPSEGFTPKNLSVFWKLPNQQ
QDYGFVLGEDLQENQSPQYKDRISLFHEELSKGNMSVLLQQVRLTDEGIYTCFVNVQNSS
SASVSLQVGAPFTKPTLHLEPSEALKPGDQVTVTCHTYDGYPEANILWQNGEGQNMTENI
TTSQVANEKGLFHVQSSLSVILETSDTYTCLVFNPVLQDVTHASLTVTGQHLSFPPLVLW
VTVGLSICLLCLLVALACVCRKHLKQTCEEEQENAGNEEHEENGELKTAMQPLKVTSPGE
DDDAECLE
Download sequence
Identical sequences Q68EV1
NP_001087555.1.7800 gi|147903934|ref|NP_001087555| gi|51258465|gb|AAH80099| gi|82234804|sp|Q68EV1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]