SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54311510|gb|AAH84875| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54311510|gb|AAH84875|
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-35
Family V set domains (antibody variable domain-like) 0.0000316
Further Details:      
 
Domain Number 2 Region: 99-222
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-26
Family C1 set domains (antibody constant domain-like) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54311510|gb|AAH84875|
Sequence length 233
Comment LOC594871 protein [Xenopus laevis]
Sequence
MSWTIPLLTLMSLCTCCAGQYVLTQPASVSVSVGGTVTLTCQGNNIGSKNVYWYQQILPS
VPRLIIYDDSKRPDGIPERFSGTNSGNTASLKISGAQGEDEADYYCQVWDNDSDAAIFGG
GTQLTVLTGDVKAPSVSIFPPSVEEIATKKATVVCSLSDFTPRGATVKWLVDGKDQTDSV
QSSGLSKQSDNLYMESSYLSLTADQWLRHETYSCKVSHQGKEIIQTLKRSECV
Download sequence
Identical sequences Q5U512
gi|54311510|gb|AAH84875|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]