SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|6090955|gb|AAF03408| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6090955|gb|AAF03408|
Domain Number 1 Region: 21-199
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.24e-69
Family MHC antigen-recognition domain 0.00000359
Further Details:      
 
Domain Number 2 Region: 207-292
Classification Level Classification E-value
Superfamily Immunoglobulin 4.72e-23
Family C1 set domains (antibody constant domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|6090955|gb|AAF03408|
Sequence length 351
Comment MHC class I antigen [Xenopus laevis]
Sequence
MDLRLVPILLTLWISAVYSGSHSLRYYYTGVSDRTFGLPECSIVGYVDEAQIVRYSSDNQ
KFEPATQWMKQKEGPEYWERETQKAKGDEAWFKHNVKVAMDRFNQSSGTHSLQMMCGCEL
REDNSIRGYNQYGYDGKEFIALDTERSVYVPTVREAQLTEQKWNSPEVNKPERDKNYLQN
ICIEWLKKYLSYGQAELERRVHPHVRISDHQSDDATELRCQAYGFYPREIDVKWVKNGRD
DVHSEAAKEILPNPDGSYQLRVTAEITPSEGDSYACHVEHSSLKEKLIVVWPGPNKDGNN
MGIIIAVVVAAVVVIAAVVGFVFYKKRNKKAYMKTASGETASNESADSVKA
Download sequence
Identical sequences Q9TPA0
XP_018085621.1.7800 gi|6090955|gb|AAF03408|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]