SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62286459|sp|P70039| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62286459|sp|P70039|
Domain Number 1 Region: 131-238
Classification Level Classification E-value
Superfamily Tumor suppressor gene product Apc 5.1e-41
Family Tumor suppressor gene product Apc 0.00000273
Further Details:      
 
Domain Number 2 Region: 353-747
Classification Level Classification E-value
Superfamily ARM repeat 6.22e-38
Family Armadillo repeat 0.055
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 5.89e-21
Family N-terminal coiled coil domain from apc 0.0000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62286459|sp|P70039|
Sequence length 2829
Comment RecName: Full=Adenomatous polyposis coli homolog; Short=Protein APC
Sequence
MAAASYDQLVKQVEALTMENTNLRQELEDNSNHLTKLETEATNMKEVLKQLQGSIEDEAM
ASSGPIDLLERFKDLNLDSSNIPAGKARPKMSMRSYGSREGSLSGHSGECSPVPVGSFQR
RGLLNGSRESAGYMEELEKERLLLIAEHEKEEKEKRWYYAQLQNLTKRIDSLPLTENFSM
QTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRVQTRVGKIHQIEEEILRIRQLLQSQVA
EAAERTPQSKHDAGSRDAEKLPDGQGTSEITASGNVGSGQGSSSRADHDTTSVMSSNSTY
SVPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCIAMRQSGCLPLLIQ
LLHGNDKDSVLLGNSRGSKEARASGSAALDNIIHSQPDDKRGRREIRVLHLLEQIRAYCE
TCWEWQEAHEQGMDQDKNPMPAPVDHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAEL
LQVDCEMYGLINDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKSCMRALVAQLKSESE
DLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALDVKKESTLKSVLSALWNLSAH
CTENKADICSVDGALAFLVSTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRE
NNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNAKDQEGLWDMGAVSMLKNLIHSKHKMI
AMGSAAALRNLMANRPAKYKDANIMSPGSSVPSLHVRKQKALEAELDAQHLSETFDNIDN
LSPKTTHRNKQRHKQNLCSEYALDSSRHDDSICRSDNFSIGNLTVLSPYINTTVLPGSSS
PRPTMDGSRPEKDRERTAGLGNYHSTTESSGNSSKRIGIQLSTTAQISKVMDEVSNIHLV
QENRSSGSASEMHCMSDERNSQRKPSSNHPQSNPFTFTKAESSTRGCPVAFMKMEYKMAS
NDSLNSVSSTEGYGKRGQVKPSVESYSEDDESKFFSYGQYPAGLAHKIQSANHMDDNDTE
LDTPINYSLKYSDEQLNSGRQSPTQNERWSRPKHIIDSEMKQSEQRQPRTTKTTYSSYTE
NKEEKHKKFPPHFNQSENVPAYTRSRGANNQVDQSRVSSNLSNNSKASKPHCQVDDYDDD
KTTNFSERYSEEEQQEDETERQNKYNIKAYASEEHHGEQPIDYSRKYSTDVPSSAQKPSF
PYSNNSSKQKPKKEQVSSNSNTPTPSPNSNRQNQLHPNSAQSRPGLNRPKQIPNKPPSIN
QETIQTYCVEDTPICFSRGSSLSSLSSAEDEIEGRERNSRGQESNNTLQITEPKEISAVS
KDGAVNETRSSVHHTRTKNNRLQTSNISPSDSSRHKSVEFSSGAKSPSKSGAQTPKSPPE
HYVQETPLMFSRCTSGSSLDSFESHSIASSIASSVASEHMISGIISPSDLPDSPGQTMPP
SRSKTPPPPQTVQAKKDGSKPIVPDEERGKVAKTAVHSAIQRVQVLQEADTLLHFATEST
PDGFSCASSLSALSLDEPYIQKDVQLKIMPPVLENDQGNKAEPEKEFIDNKAKKEDKRSE
QEKDMLDDTDDDIDILEECIISAMPRKPSRKNKKVPQPTPGKPPPPVARKPSQLPVYKLL
SSQNRLQTQKHVNFTHSDDMPRVYCVEGTPINFSTATSLSDLTIESPPSEPTNDQPNTDS
LSTDLEKRDTIPTEGRSTDDTDASKPLNPTTVLDEDKAEEGDILAECIHSAMPKGKSHKP
YRVKKIMDQINHTSAATSSGNSRSMQETDKNKPTSPVKPMPQSIGFKERLKKNTELKLNP
NSENQYCDPRKPSSKKPSKVANEKIPNNEERTKGFAFDSPHHYTPIEGTPYCFSRNDSLS
SLDFEDDDIDLSKEKAELRKEKGTKDTDQKVKYKHENRAINPMGKQDQTGPKSLGGRDQP
KALVQKPTSFSSAAKGTQDRGGATDEKMENFAIENTPVCFSRNSSLSSLSDIDQENNNKE
TEPLKQTGTSETQLGLRRPQTSGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECI
SSAMPKKRKPSKIKNEVGKSRSNSVGGILAEEPDLTLDLRDIQSPDSENAFSPDSENFDW
KAIQEGANSIVSRLHQAAAAGSLSRQGSSDSDSILSLKSGISLGSPFHLTLDKEEKTITS
NKGPKILKPAEKSALENKKTEEEPKGIKGGKKVYKSLITGKSRSSSDFSSHCKQSVQTNM
PSISRGRTMIHIPGVRASSPSTSPVSKKGPVFKNVPSKGSNENPSSSSSPKGTKPLKSEL
VYGSRPSSTPGGSSKGNSRSGSRDSASSRPSPQPLSRPLQSPGRNSISPGKNGISPPNKF
SQLPRTTSPSTASTKSSGSGRMSYTSPGRQLSQPNLSKQSGLPKTHSSIPRSESASKSLN
QNVNTGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESASFE
SLSSSSRADSPPRSQTQTPALSPSLPDMALSTHSIQAGGWRKMPPNLNPAAEHGDSRRRH
DISRSHSESPSRLPITRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKS
EDEKQQVCSFPGPRSECSSSAKGTWRKIKESEILETPSNGSSSTIAESNCSLESKTLVYQ
MAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNSPPVIDNVLDQGQKEEAAKDCHTRHNSG
NGNVPLLENRQKSFIKVDGLDTKGTDPKSLINNQQETNENTVAERTAFSSSSSSKHSSPS
GTVAARVTPFNYNPSPRKSNGENSTSRPSQIPTPVTNSTKKRDSKTETTDSSGSQSPKRH
SGSYLVTSV
Download sequence
Identical sequences P70039
NP_001084351.1.7800 gi|148236607|ref|NP_001084351| gi|1809290|gb|AAB41671| gi|62286459|sp|P70039|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]