SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|6429055|gb|BAA86869| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6429055|gb|BAA86869|
Domain Number 1 Region: 399-693
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-78
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 22-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-30
Family Spermadhesin, CUB domain 0.0000231
Further Details:      
 
Domain Number 3 Region: 182-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-27
Family Spermadhesin, CUB domain 0.0000215
Further Details:      
 
Domain Number 4 Region: 298-358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000375
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 132-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000726
Family EGF-type module 0.0016
Further Details:      
 
Domain Number 6 Region: 362-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000104
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|6429055|gb|BAA86869|
Sequence length 698
Comment mannose-binding protein-associated serine protease (MASP) [Xenopus laevis]
Sequence
MRIPLLFSICLWMLSEAEVIQLTDMFGEIRSLFFPDSYPSDSEVTWNITVPRGFSLKLYF
MHFDLEPSYLCEYDYAKVESEDQVIANFCGKESTDTEQAPGRQIITSPSNFLSLTFRSDF
SNEERFTGFDAHYSAIDIDECTEKSDEDLVCDHHCHNYIGGFYCSCRFGYLLHTDNRTCK
VECSDNLFTQRSGLISSPDYPSPYAKSSDCRYRIELEEGFVINLHFDDNFDVEDHPEVKC
PYDYLKIKTGKNEFGPLCGEKSPGRKETGSNTVQILFHRYNSGENGGWRLSYSVTGMPCP
NLHPPMNGKLEPPQSEYTFKDQVVISCNQGYRVLKDNVEMESLQIECRKDGTWSNQIPPV
QIVDCKKPKEIENGFITYSTAENRTTFQSSFNYSCREPYYMMVPNITLVYTCDASGEWTS
QEIGAKIPTCQPVCGVPRFSRSALARIAGGKTAKRGISPWIAMFSDSQNNQPFCGGALIS
NKWIVTAAHCLHHELDTEDTDLNSLKWFELSSFKVILGKHRTLKKDDTEQTFQAKNLILH
PNYKPKTFRFDIALVELSDKAFLNDYVMPICLPEKQVQQDEHVIVSGWGKHFLKRLPDSL
MEVEIPVVGQTLCKTVYQTLELLVTDEMICAGFKEGGKDACSGDSGGPMVTKNELKKHWY
LAGTVSWGVGCGKKIRYGMYSDVYKNLDWIKKKSGVQY
Download sequence
Identical sequences Q9PU71
gi|6429055|gb|BAA86869|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]