SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71679775|gb|AAI00169| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71679775|gb|AAI00169|
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.49e-23
Family FHA domain 0.00005
Further Details:      
 
Weak hits

Sequence:  gi|71679775|gb|AAI00169|
Domain Number - Region: 588-693
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00451
Family Pentapeptide repeats 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71679775|gb|AAI00169|
Sequence length 1109
Comment LOC734164 protein [Xenopus laevis]
Sequence
MPLFGEIVVIKRNGTDGTHFPLTATSCLFGRKSECDIRIQLPHVSKEHCKVEVKANKEVF
VINISAVNPTQLNGIAIQQPELLKHGDIITIIDRSFRFEQPPTNPHRQSTGGNSLSSKLV
EDEPSSIKGKASKLTRKSEGNVSRTTHTRLSLPISPHRRSSREKKDLSPFGELYEMLKNK
VHLKQEHAKTPAKQIMENGDCIFTPVTTRRSLGNVKGTRESSLNNTLQFESQELHVESAT
LSEKTASALKSPSRGRPSTKLKQQRLSGKRDSPAKSVSELPHEEISISFQDNGQKQPNDK
LTPRRRRSTSKEQTPVKSGVSVLPLSRNRSPRSASPKDLHVNAQVSKPPQKRRSSELELP
EPTPKRKRVSFGGHLSPEFFDKRLPPNSPLQRGATPSRRSLSLAATRVIRKSFGGFKQAV
IKETFEPAKRSPGKASPAKRSPGKASPAKRSPAKASPAKMTPAKRSPAKASPAKMTPAKR
SPAKASPAKITPAKRSPAKASPAKITPAKRSPAKASPAKITPAKRSPAKASPAKMTPAKR
SPAKASPAKMTLAKRSPAKMTLAKQSPAKASPAKMTPAKRSPAKMTPAKRSPAKMTPAKR
SPAKMTPAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAKR
SPAKMTPAKRSPAKMTPAKMTPAKRSPAKMTPAKRSPAKMTPAKRSPAKMTPAKRSPAKM
TPAKRSPARASPAKRSPARASPVKRSPARASPAKMTPAKRSPANVKAAKRSSAKMTPAKF
SPAKRSPAKVTPAKKSPATIYSKGRFSISQTDTPPLNYVHVPNTEENELSAQTPRKSRKS
ISLKKTPGRRSRKLETFEILRSRRRSGATEANLLVAKSWADVVRIGVPKNHKKSEKQAHK
AVPTKRKQKPKTPARRFIDRSGTGHADSPATILVGRAHTRTVNPTGYVPKIVQNQAIKII
NDQNESFTGMSELFNTPAQVKPRKSGRSGGLQVNTPQALIVDVSLMQTPEELGEMVVSPI
NGSPSTTRKKQYSRDAVSRLLRSPVSPASPKGIEKISETSKDSELIEKETATLNGNHSVK
GGAKPEKKKRETMGLTGVKRIMRTPKKKK
Download sequence
Identical sequences Q498L4
gi|71679775|gb|AAI00169|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]