SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73544696|gb|AAZ78136| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73544696|gb|AAZ78136|
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-18
Family Fibronectin type III 0.00078
Further Details:      
 
Weak hits

Sequence:  gi|73544696|gb|AAZ78136|
Domain Number - Region: 103-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0158
Family V set domains (antibody variable domain-like) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73544696|gb|AAZ78136|
Sequence length 176
Comment leptin receptor [Xenopus laevis]
Sequence
VKPDPPDDLQAEIMKQGTLKVFWLKPISAAYELKYQVRYSVKAPETNSQVYLLVNETSVI
ISDIQPCTEMSIEVRCINSHKTGLWSNWSKTWVLNSQDVFYYPKKVLASSGSSMSVSCLF
CDNGKKVPSGNITWWLNFGEKIPEHQYRAISDYFSEVTLTDLNTTKPKGKFRYDAL
Download sequence
Identical sequences Q3YA37
gi|73544696|gb|AAZ78136|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]