SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76779590|gb|AAI06492| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76779590|gb|AAI06492|
Domain Number 1 Region: 85-183
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-17
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 2 Region: 179-278
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000837
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 3 Region: 8-72
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000698
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76779590|gb|AAI06492|
Sequence length 287
Comment LOC733364 protein [Xenopus laevis]
Sequence
HKMVVQGLHPVRQQYQQIETDVVLHCDTLSDMEWRLNGKKIHHNKENLSKTHLTLLQVHK
DQEGIYTCHDIHSNQTLTEIELHMGFPPMNLTSRCWATSYPEQIQCTWNLHHDTQLNTTF
ITTYRLGLSEPDSQCEQSKLHPNSCIISDFQMFAEVPYLLNVTAKNPLGSITHLLPFIVE
DIIRPDPPENVRISIITGESRKLLLRWDPPHSWPLPEMFPLKYLIRYKRVGAKYYKTIGP
YEQSYFYLPVTQLRSVIQAQVAAKDFTDFGEISEWSMEATGSLLGLS
Download sequence
Identical sequences Q3KPX7
gi|76779590|gb|AAI06492|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]