SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82181988|sp|Q6AZG8| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82181988|sp|Q6AZG8|
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000319
Family Glutathione peroxidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82181988|sp|Q6AZG8|
Sequence length 201
Comment RecName: Full=Uncharacterized protein C1orf93 homolog
Sequence
MGSLDLAKAGAILVKNALSGEMVELKSLWKEQTTVLLFLRRFGCQICRWIAKDMGKLKES
CDVHQIRLVGIGPEEVGLKEFLDGNFFNGELYIDDSKQSYKDLGFKRYSALSVIPAALGK
KVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLETIVQTL
GITANVTESQRPQCNDDVCTR
Download sequence
Identical sequences A0A1L8FMM1 Q6AZG8
NP_001087128.1.7800 gi|148231275|ref|NP_001087128| gi|50604018|gb|AAH78028| gi|82181988|sp|Q6AZG8|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]