SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82181994|sp|Q6AZH6| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82181994|sp|Q6AZH6|
Domain Number 1 Region: 129-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-32
Family UAS domain 0.019
Further Details:      
 
Domain Number 2 Region: 320-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.43e-23
Family UBX domain 0.0052
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.0000378
Family TAP-C domain-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82181994|sp|Q6AZH6|
Sequence length 445
Comment RecName: Full=FAS-associated factor 2-A; AltName: Full=UBX domain-containing protein 8-A
Sequence
MAALEERELSQEQTEKLLQFQDLTGIESMDQCRQTLQQHNWNIEAAVQDRLNEQEGVPRV
FNNPPNRPLQVNTADHRVYSYVVSRPQPRGLLGWGYYLIMLPFRITYYTLLDIFRFTLRF
IRPDPRSRVTDPVGDVVSFIHLFEEKYGRIHPVFYQGTYSQALNDAKQELRFLLVYLHGE
DHQDSDDFCRNTLCTPEVTHFINSRMLFWACSTNKPEGFRVSQALRENTYPFLGMIMLKD
RRMTVVGRLEGLMQPQDLINQLTFIIEANQTYLVSERLEREERNETQVLRQQQDEAYLVS
LRADQEKERKKKEKQEQKRREEEEAQRKQMLEERKKRNLEEEKERKSECLPAEPVPDHPD
NVKIIFKMPNGTRVERRFLFTQSLSVIHDFLFSLKETPEKFQIVTSFPRRVLPCLPSEEI
PVPPTLQEAGLSQSQLLFVQDLTDD
Download sequence
Identical sequences Q6AZH6
NP_001087113.1.7800 gi|148224762|ref|NP_001087113| gi|50603676|gb|AAH78001| gi|82181994|sp|Q6AZH6|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]