SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82234511|sp|Q66KX2| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82234511|sp|Q66KX2|
Domain Number 1 Region: 222-314
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 126-226
Classification Level Classification E-value
Superfamily Immunoglobulin 7.12e-16
Family C1 set domains (antibody constant domain-like) 0.069
Further Details:      
 
Domain Number 3 Region: 30-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000108
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|82234511|sp|Q66KX2|
Sequence length 390
Comment RecName: Full=Cell adhesion molecule 4; AltName: Full=Immunoglobulin superfamily member 4C; Short=IgSF4C; Flags: Precursor
Sequence
MAPALTALNRCFVLGILLLVTAGTAFSQEVQAENVTVVEGSTVEISCHLHQYDGSIVVIQ
NPVRQTLFFNGTRALKDTRFQLVEFTQKVVKIHLSDAKLEDEGGYFCQLYTEDTHHQIAT
LTVIVPPDNPLVEVKEQAVEGGEIELTCISPRTKPAATLRWYRDRKELKGFTSKQENGKT
FSITNSIRFNVDRKDDGNIVTCEASHPALKGQKKQTQYELDVQFSPTASIQPSQSLVRDG
DELNLKCEVTGNPRPTEIIWTRLNDSLPDRAQIQGDLLSFPSLNLQDNGTYSCQVSNKHG
RSSDQYVLVVYDPGAIIEAQTQVPYAVIGGILALLVFLVICILIVMVWCSVRQKGSYLTH
EASGLDEHGEAREAFLNGGENHKRKEEFFI
Download sequence
Identical sequences Q66KX2
NP_001087300.1.7800 gi|148222099|ref|NP_001087300| gi|51593178|gb|AAH78527| gi|82234511|sp|Q66KX2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]