SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82241582|sp|Q7ZXX1| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82241582|sp|Q7ZXX1|
Domain Number 1 Region: 224-315
Classification Level Classification E-value
Superfamily Immunoglobulin 9.55e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 125-228
Classification Level Classification E-value
Superfamily Immunoglobulin 7.2e-16
Family C2 set domains 0.077
Further Details:      
 
Domain Number 3 Region: 21-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000323
Family I set domains 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82241582|sp|Q7ZXX1|
Sequence length 394
Comment RecName: Full=Cell adhesion molecule 3; AltName: Full=Immunoglobulin superfamily member 4B; Short=IgSF4B; Flags: Precursor
Sequence
MHHPVILLLCLSSLAGAANLPPEDLSQPVTADVIVPTGGTAILKCTVQEHLESSLQWSNT
AQQTLYFGEKRALRDNRIQLVHSSPNELTISISNVVLSDEGEYTCSIFTMPVRTAKAVVT
VLGVPQKPQVSGFESAFKENDKAKLRCTTSGSKPAANIKWYKGPEELEGAKTSVLEDGNG
KTFTVKSFIEFDVTKDDDGAEITCAVGHESLHDSAKSSSHKIQVQYKPTAKIESRPSMPR
EGDKLRLQCDAYGNPVPDNYVWERENGEVPLLANIEGNSLVFFNLNKTDSGTYTCKASNT
LGTFITHYKLDVNDPSPIPSTSSIDHAVIGGVVAVIAFLLFCLLIVLGRYLIRHKGTYLT
HEAKGSDDAPDADTAIINAEGGQGGSDDKKEYFI
Download sequence
Identical sequences Q7ZXX1
NP_001080468.1.7800 gi|147901041|ref|NP_001080468| gi|28277261|gb|AAH44084| gi|82241582|sp|Q7ZXX1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]