SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82243533|sp|Q8JI28| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82243533|sp|Q8JI28|
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.22e-59
Family Astacin 0.0000663
Further Details:      
 
Domain Number 2 Region: 768-879
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 348-457
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-37
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 4 Region: 462-566
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-36
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 613-723
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 6 Region: 904-998
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-27
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 7 Region: 724-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000978
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 569-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000206
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82243533|sp|Q8JI28|
Sequence length 1007
Comment RecName: Full=Tolloid-like protein 1; AltName: Full=Metalloprotease xolloid-like; AltName: Full=Xenopus tolloid-like protein 1; AltName: Full=Xlr; Flags: Precursor
Sequence
MNMPSWLIFLLTGWTFCGNFFACGGLDYDYPNYENEEEKNEAIDYKDPCKAVVFWGDIAL
DEEDLKMFHIDRTIDLTQHSNEKLGHTTGGLEEHDLSKKRGALYQLIERIRRFGSGQENT
TANSQKVDNNQSGKSKKIRIPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHW
EKHTCVTFIERTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHV
IGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVHSLGESYDFDSIMHYARNTFS
RGMFLDTILPSRDENGLRPPIGQRTRLSKGDIAQARKLYRCPACGETLQESTGNFSSPGF
PNGYPSYTHCIWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWKKSPLLGRFCG
DKLPDVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKDAGQIQSPNYPDDYRPL
KECVWKITVAENYNVGLTFQAFEIERHDNCAYDYLEVRDGSSENSPLIGHFCGYDKPEDI
RSTSNTLWMKFVSDGTVNKAGFAANFLKEEDECARPDNGGCEQRCVNTLGSYKCSCDPGY
ELAPDKKSCEAACGGLLTKLNGTITTPAWPKEYPPNKNCVWQVVAPSQYRISMKFDYFEL
EGNEVCKYDYVEVRSGLSSDSKLHGKFCGTEVPEVITSQFNNMRIEFKSDNTVSKKGFRA
HFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFVLHDNKHDCKEAECEHRIHSSNGVI
TSPNWPDKYPSRKECTWEISATPGHRVKLSFSEFEIEQHQECAYDHLEVFDGETEKSSIL
GRLCGSKVPEPLVATGNEMFIRFVSDASVQRKGFQATHSTECGGRLKAEAKPRDLFSHAQ
FGDNNYPVQADCEWILMTERGLRIELNFQTFEVEEEADCGYDFMELFDGHDASAMRLGRF
CGSGPPEEIVSTGDAVLIHFHTDDTISKKGFHIRYRSVKYQDILHTK
Download sequence
Identical sequences Q8JI28
NP_001083894.1.7800 gi|148222184|ref|NP_001083894| gi|21666355|gb|AAM73675| gi|82243533|sp|Q8JI28|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]