SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83318212|gb|AAI08508| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83318212|gb|AAI08508|
Domain Number 1 Region: 432-706
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-70
Family Eukaryotic proteases 0.00000838
Further Details:      
 
Domain Number 2 Region: 21-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 3 Region: 186-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-27
Family Spermadhesin, CUB domain 0.0000343
Further Details:      
 
Domain Number 4 Region: 370-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.00037
Further Details:      
 
Domain Number 5 Region: 303-373
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.00018
Further Details:      
 
Domain Number 6 Region: 134-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83318212|gb|AAI08508|
Sequence length 708
Comment MGC130869 protein [Xenopus laevis]
Sequence
MWLWVVLLLGTVAYSQNNKRPLYGTITSPNYPKPYPNSNESTWNITVPEGYHISLNFLVF
DIEPSENCYYDFVKVMADGKELGQFCGSVNSLTNPTRRQFVSTGTQMRIHFQSDFSNELD
GDIVPYKGFMAFYQAIDKDECAPPSDNSATWTPPCEHVCHNYVGGYFCSCFPGYHLQSDS
RSCKVECSSEMFTEESGFISSPGYPEPYPPDLKCNYSIRLEEGLQISLSFQKPFEIDYHP
KARCPYDTLEVFAGDMMLNSFCGSDSPGMVMTRSHTVDIVFETDDSGDSKGWSLHYTSEA
IPCPNPKAWDKYTIISPKQNIYRMRDYIVVTCQTGYKIMEDRKELGSFSTICQKDGTWHR
PIPRCEIVTCKDPPVLTNGQYKFLTAPGNLEYESVIQYHCNEPYYKMVTAKDSDTFTCSA
QRQWKDESGGNKIPLCIPVCGKPDNPVTNFGRILHGKKAAPGNFPWQVFISRMGRAGGAL
IGEHWVLTAAHVLQPENEEKEDNDPTKVHIFMRSLDVNQLLKIGNYPVEAFYVHPKYRRG
RYDNDIALIRLKNPVVMGENVSPVCLPSPEDEDDIYQNHRNGYVSGYGQTENRTIANELR
YVSVPVVSWSACETYVNDKKLKVKDVSERQKYSLTRNMFCAGFPEESLNKGDSCEGDSGG
AYTTPNRQDTWVATGLVSWGIGCGQGYGIYTKVSNYLDWIKSYTEKDE
Download sequence
Identical sequences Q2VPN1
NP_001090130.1.7800 gi|148232445|ref|NP_001090130| gi|83318212|gb|AAI08508|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]