SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85681147|sp|P55869| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85681147|sp|P55869|
Domain Number 1 Region: 57-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000312
Family Thioltransferase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85681147|sp|P55869|
Sequence length 185
Comment RecName: Full=Anterior gradient protein 2; Short=XAG-2; AltName: Full=Secreted protein np77; Flags: Precursor
Sequence
MQTGLSLACLVLLCSVLGEAALRKPKRQAGATDTNGAAKSEPAPVKTKGLKTLDRGWGED
IEWAQTYEEGLAKARENNKPLMVIHHLEDCPYSIALKKAFVADKMAQKLAQEDFIMLNLV
HPVADENQSPDGHYVPRVIFIDPSLTVRSDLKGRYGNKLYAYDADDIPELITNMKKAKSF
LKTEL
Download sequence
Identical sequences A0A1L8EPL0 P55869
NP_001081669.1.7800 gi|148232038|ref|NP_001081669| gi|2565327|gb|AAB81968| gi|50603714|gb|AAH78083| gi|85681147|sp|P55869|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]