SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|87133094|gb|ABD24285| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|87133094|gb|ABD24285|
Domain Number 1 Region: 40-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000815
Family I set domains 0.041
Further Details:      
 
Weak hits

Sequence:  gi|87133094|gb|ABD24285|
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0126
Family I set domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|87133094|gb|ABD24285|
Sequence length 225
Comment FL1.11 type I transmembrane receptor [Xenopus laevis]
Sequence
VPSAQLEHSGKYTCEIKAQSGSVKKESDPKSIQIKAQKLSGVRVSLEPTGEQVIAGEKLE
ILCSVEKGMGLLSYSWCKQYNLSCDTKEATALEQRFVVESVSEDYGGEYQCIVTRAATQD
SIQSANISISVQEKSYAVLGIVSTVSFLVLLFVTAIVAFKCRTNICCHSTKSSGGSVTKD
QCGTGPRQQADDHYTTLEHMKPSAEQPVHYSRCHSWNRCVQRLLQ
Download sequence
Identical sequences B3RFN5
gi|87133094|gb|ABD24285|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]