SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|115528275|gb|AAI24895| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115528275|gb|AAI24895|
Domain Number 1 Region: 171-239
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-18
Family Homeodomain 0.0000519
Further Details:      
 
Domain Number 2 Region: 44-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000037
Family LIM domain 0.027
Further Details:      
 
Domain Number 3 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000112
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|115528275|gb|AAI24895|
Domain Number - Region: 107-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00104
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|115528275|gb|AAI24895|
Sequence length 354
Comment LOC100126604 protein [Xenopus laevis]
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECSQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCNIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGGSDPLSPLHPGRPLQMAAEPICARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
ILIKQLQQQQPNDKTNIQGMTGTPMVASSPERHDGGLQANPVEVQTYQPPWKVLSDFALQ
SDIDQPAFQQLTCFSQVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
Download sequence
Identical sequences Q08B34
NP_001104188.1.7800 gi|115528275|gb|AAI24895| gi|144952770|gb|ABP04039| gi|160420135|ref|NP_001104188| gi|213626865|gb|AAI70282|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]