SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125371|sp|P13406| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125371|sp|P13406|
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-84
Family Protein kinases, catalytic subunit 0.00000000065
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-41
Family SH2 domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-27
Family SH3-domain 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125371|sp|P13406|
Sequence length 537
Comment RecName: Full=Tyrosine-protein kinase Fyn; AltName: Full=Proto-oncogene c-Fyn; AltName: Full=p59-Fyn
Sequence
MGCVQCKDKEATKLTDERDNSLTQSLGYRYGTDPTPQHYPSFTVTTIPNYNNFHATAGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
ALKLPNLVDMAAQVARGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences P13406
NP_001079077.1.7800 gi|125371|sp|P13406| gi|148230543|ref|NP_001079077| gi|214163|gb|AAA49719| gi|64702|gb|CAA36435|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]