SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901476|ref|NP_001089496| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901476|ref|NP_001089496|
Domain Number 1 Region: 80-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00000624
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147901476|ref|NP_001089496|
Sequence length 229
Comment glutathione S-transferase alpha 4 [Xenopus laevis]
Sequence
MSQKPKLHYFNGRGKMESIRWLLAAAGVEFEEEFLETREQFEALVQDEALVFKQVPVVEI
DGMKLVQTKAILQYIAAKYNLYGKDLVERVLIDMYVEGTTEFMEVIMSQPFLQNEEKGMQ
PDVFIQKAKTRYLSVYEKILRNHGQDFLVGNRFSWADIQLLEAILMIEEKSADVLSDFSL
LQDFKQRISEIPTIKAFLLPGSPRKPQPDDKYVEAVNAVLKMYYKVAFN
Download sequence
Identical sequences Q4V7T2
NP_001089496.1.7800 XP_018120057.1.7800 gi|147901476|ref|NP_001089496| gi|66910972|gb|AAH97734|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]