SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901528|ref|NP_001079150| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901528|ref|NP_001079150|
Domain Number 1 Region: 220-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-77
Family Protein kinases, catalytic subunit 0.00000000171
Further Details:      
 
Domain Number 2 Region: 112-250
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-38
Family SH2 domain 0.0000139
Further Details:      
 
Domain Number 3 Region: 52-136
Classification Level Classification E-value
Superfamily SH3-domain 2.54e-20
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147901528|ref|NP_001079150|
Sequence length 496
Comment hemopoietic cell kinase [Xenopus laevis]
Sequence
MGCIKSKDSNTTGKSLGPPESTQTHYVKDPTSTVTMTKPERSSKHPREEGQEEVVLLALY
DYDGVHPGDLTFRKGDHLLLKKESGEWWEACLISTGEEGFVPSNYVAYFNSLESEEWYFK
GMSRKEAERQLLSPVNKSGAFMIRDSETMKGCFSLSVRDSGDTVKHYKIRTLDDGGFFIS
TRIPFPSLPELVRHYQGKVDGLCQCLTIPCQTVRPEKPWEKDAWEIPRESLSLQKKLGAG
QFGDVWLAMYNGHTKVAVKTMKPGSMSPGAFLEEANLMKSLQHDRLVRLHAVVTQGEPIY
IITEYMQKGSLLDFLKSEEGSDQPLIQLIDFSAQIAEGMWFIEQRNYIHRDLRAANCLVS
ETLLCKIADFGLARVIEDSEYTAREGTKFPIKWTSLEAANYGSFTIKSDVWSFGVLLTEI
ITYGRTPYPGMSNSEVITALERGYRMPCPSTCPKELYSIMLQCWQQDPEQRPTFEYLQSI
LEDFFTATETQYQAQP
Download sequence
Identical sequences O93411
gi|147901528|ref|NP_001079150| gi|3411274|gb|AAC31209| NP_001079150.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]