SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901644|ref|NP_001091123| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901644|ref|NP_001091123|
Domain Number 1 Region: 29-138
Classification Level Classification E-value
Superfamily PH domain-like 1e-31
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000614
Further Details:      
 
Domain Number 2 Region: 234-341
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.96e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000297
Further Details:      
 
Domain Number 3 Region: 401-460
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000968
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147901644|ref|NP_001091123|
Sequence length 472
Comment hypothetical protein LOC100036872 [Xenopus laevis]
Sequence
MSRGGPKMGARLQDNISSSLLLPQENQKLFQLLGRKCTTLATTVVQLLVAQGRDRWTKQF
VGVMCLVKDNPRRSYFFQLFDLRAEKMVWEQEIYEQLNYNTPRLYFHTLCSNDCQTGLNF
ADEVEAAAFQLVIEEKLKKKQHRQDRRQNLPPPPPVSDDRRTSLPLPLPPGPFPNGPTSP
LPLAPSQSLNMPAVSIPNPDVTSARYRALTAPSDKGKNKKGKKKFSKADIGAPSGFKHVS
HVGWDPNSGFDVNQLDPDIRDLFSRAGISDAQLEDAETSKLIYDFIEQQGGVEAVKQEMR
KGEPIPPPPPPSRNAPPAPSQSRGRTGPLPPPPVRGSSAPPLPPPSRSTLPTPPPTVRSG
GPPPPPPPPPPSAPALPATGGPAPPPPLPVSQSTPSAAPSGGRGALLDQIRHGIQLNKVT
DSAEPPLSPQPSTEGLVGALMHVMQKRSKAIHSSDDDEEDGADDDDDDEWDD
Download sequence
Identical sequences A1L2K2
NP_001091123.1.7800 gi|120538251|gb|AAI29569| gi|147901644|ref|NP_001091123|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]