SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147902372|ref|NP_001091190| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147902372|ref|NP_001091190|
Domain Number 1 Region: 224-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-82
Family Protein kinases, catalytic subunit 0.000000000975
Further Details:      
 
Domain Number 2 Region: 116-258
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-38
Family SH2 domain 0.00000898
Further Details:      
 
Domain Number 3 Region: 42-165
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-22
Family SH3-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147902372|ref|NP_001091190|
Sequence length 502
Comment hypothetical protein LOC100036955 [Xenopus laevis]
Sequence
MGCGCSSEYEDDWIENFDVCEHCHLPREKTELISCIDKDPLVSYTGQNPPSSPLHDNQVV
ALYNYEPMHAEDLGFEAGEKMHILEQKGEWWKAKSLRTGQVGFIPHNFVASENGIESELW
FFKDLGRKDAERQLLAPGNQQGSFLVRESETNKGSYSLSVRDLDQNHGEVVKHYKIRNLD
SGGFYISPRKSFQTLQELVQFYRRSSDGLCTLLKEPCQTQRPQKPWWADEWEIPRNNLQL
VKKLGAGQFGEVWMGYYNGHTKVAIKSLKSGTMSPEAFLAEANLMKQLQHPRLVRLNAVV
TQEPIYIVTEYMENGCLVDYLKTSEGLKLTIYKLIDMSAQVSEGMAFLERRNYIHRDLRA
ANILVSESLCCKIADFGLARIIVDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFG
VLLTEIVTYGRIPYPGMTNPEVIENLERGYRMPQPDNCPMELYELMVRCWKEEPEERPTF
EFLRSLLEDFFTATEGQYQSQP
Download sequence
Identical sequences A1L2U4
gi|120538739|gb|AAI29713| gi|147902372|ref|NP_001091190| NP_001091190.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]