SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147903661|ref|NP_001086969| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147903661|ref|NP_001086969|
Domain Number 1 Region: 39-141
Classification Level Classification E-value
Superfamily TPR-like 4.09e-17
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number 2 Region: 791-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000069
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number 3 Region: 850-881
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000169
Family CCCH zinc finger 0.0035
Further Details:      
 
Domain Number 4 Region: 718-747
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000314
Family CCCH zinc finger 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|147903661|ref|NP_001086969|
Domain Number - Region: 461-489
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00412
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number - Region: 584-615
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00765
Family CCCH zinc finger 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147903661|ref|NP_001086969|
Sequence length 920
Comment zinc finger CCCH-type containing 7B [Xenopus laevis]
Sequence
MARQKRKEDIEKGLQFIQSTIPFHGSQADYEHFLQQLVRNLFAEGNDLYRDGDPKLALRQ
YTEGLTVAEYAMSEELTIPEELLSKLCVNRSCCYFTMGLYEKSLEDSESALSHDKENMRA
LYRKAKALDQLGRHQEAYGCISDKLLALVQDESVTELAQELVQKLGLKQRKAYKRPQQEL
ESIGFLSNGTSTSTSSQASSNSLGSLDDIDIGSDLHIEGLKAAVSPASTGFPSAAGSLND
FADCDIIGDELDSFLDAGITSIPPSQVPHLIPMYPTGSPMLSSLGNNVLPSPLPPASFGL
LDSQKLTRHCEKPGYNMNLIRRAEPRLDTLDSFESIREPMDCLDTFTNEPKHLLFPSTKT
SQKHKPGVNNINHVKADTALLHTRGLLSTLPANPLAQTYEFKQACPQCYVKTGLKALDYA
HREKLEHKCKRNILMARRKSSENKTWLRIRPRPPNVTGPYVLCKDIQTRQDCKYREDCTF
AYYEEEIDVWNEERKFTLRRDQLFLLPSGVMAGTLAWLLQEHKGIFIFLCQACFDSKPRV
ICKKSQESQTVCTKQHSFLDNKCLVHVYNSGTIKYSKIRPLQSHFHMDLCRHEMQYGCIQ
EDTCSFAHSPVELSVWILQRQSGTTQEEIVQESEQAWKVPEPKGKILPKCLDMKMKFVCS
QCLSTGQHIESDRDGKYCAAKARHSWTKEKRVLLVMCKAKKKWASVRPLPCIPQFPQHYE
ICIHVQNGKKCQYSGNCTFAHSTEEKDLWTFMKDNKVLDLQLVYDMCQKNNCTSEKAEKG
ASGPQKETEKQILMPTDYADLMAGFHCYLCGKNSNSERQWQKHIQSEKHKDRVFTTESED
TTWKFRFPAGEFKLCDRFGETKSCPHESNCQFAHGQEELDEWLKRRDVLLQKVSKARKDM
LLEPTDSDFGKYTFLLKDVA
Download sequence
Identical sequences Q6DCZ5
gi|147903661|ref|NP_001086969| gi|50418255|gb|AAH77837| NP_001086969.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]