SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147904585|ref|NP_001085431| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147904585|ref|NP_001085431|
Domain Number 1 Region: 17-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.49e-67
Family BAR domain 0.00041
Further Details:      
 
Domain Number 2 Region: 241-273,301-358
Classification Level Classification E-value
Superfamily SH3-domain 3.38e-18
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147904585|ref|NP_001085431|
Sequence length 359
Comment SH3-domain GRB2-like endophilin B1 [Xenopus laevis]
Sequence
MEFSVMKLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLENLLAKAECTKVWTEKIMKQT
EVLLQPNPNARIEEFVYEKLDRKAPSRLNSEEQLAQYMSDAGNEFGPGTAYGNALIKCGE
TQKRIGVAHRELIQTAAINFLTPLRNFIEGDYKTMTKEKKLLQNKRLDLDAAKTRLKKAR
VTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYFAQSYQ
YMLDLQKQLGSFPSTFVSNNNQSTPMQSVPVPSVSASAQAPSAKSSLVTSGFTELKASNG
SRKARVLYDYDAANSSELSLLADEVITVYSMPGMDSDWLMGERGHQKGKVPITYLELLN
Download sequence
Identical sequences Q6GQK5
NP_001085431.1.7800 gi|147904585|ref|NP_001085431| gi|49114774|gb|AAH72737|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]