SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147905236|ref|NP_001082302| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147905236|ref|NP_001082302|
Domain Number 1 Region: 853-935
Classification Level Classification E-value
Superfamily DEATH domain 1.06e-21
Family DEATH domain, DD 0.0000109
Further Details:      
 
Domain Number 2 Region: 158-248
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000349
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 248-300
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 302-356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000746
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 5 Region: 51-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000426
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147905236|ref|NP_001082302|
Sequence length 943
Comment netrin receptor UNC5B precursor [Xenopus laevis]
Sequence
MYLSRNPSGAALAAILVALILSCNFPSSTAGIEYSDVLPDSFPSAPAESLPHFLLEPEDA
YIVKNKPVELVCKANPATQIYFKCNGEWVNQNDHITKERVDDVTGLVVREVQIEVSRQQV
EELFGLEDYWCQCVAWSSAGTTKSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPP
EGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVSKNIVAKRRST
TATVIVFVNGGWSSWTEWSPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNT
MCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLCMQNK
RVLGETKSRLLESTGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCREFDTDITDSSAAL
TGGFHPVNFKTSRHDNSQLIHPAMQPDLTANAGIYRGNMYALQDSADKIPMTNSPLLDPL
PNLKIKVYNSSTVGSSPGIHDGNNLLGTKPTGTYPSDNNIMNARNKNMSMQHLLTLPRDS
SNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTIL
SPIITCGPTGLLLCKPVILTVPHCADINTSDWILQLKTQSHQGNWEEVVTLNEETLNTPC
YCQLESHSCHTLLDQLGTYAFVGESYSRSAIKRLQLAIFAPMLCTSLEYNLKVYCVEDTP
DALKEVLELEKTLGGYLVEEPKLLMFKDSYHNLRLSIHDIPHSLWRSKLMAKYQEIPFYH
IWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTLLEENVKSFDPFCSQ
AENSVTTHLGPYAFKIPFSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASP
TGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATDGDC
Download sequence
Identical sequences Q8JGT4
NP_001082302.1.7800 gi|147905236|ref|NP_001082302| gi|22035305|gb|AAM34486| gi|54036590|sp|Q8JGT4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]