SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147907178|ref|NP_001083276| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147907178|ref|NP_001083276|
Domain Number 1 Region: 291-528
Classification Level Classification E-value
Superfamily SIS domain 2.05e-18
Family mono-SIS domain 0.0052
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily SIS domain 0.00000000238
Family mono-SIS domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147907178|ref|NP_001083276|
Sequence length 619
Comment glucokinase regulatory protein [Xenopus laevis]
Sequence
mrgtrkyqhvietpdpgkwelagyeeslpiseksnpmtreldkadpsqlvqllrdcdaei
fqeedenlihyhrlysesvlktmgdvakrvqevlknpddslvvlsgcgtsgrlalllans
fngllkglhktpcycyimsggdrsivtsqessednpqlgaqelekvcegkknvlfigisc
glsapfiagqldfcmrhldvylpvlvgfnpvsmarneriegwhssfrqvaerlqtlhdsq
kgfilnpavgpegvsgssrmkggsatkilletlllvahkaesnvpvtekclleilrtyer
ahkvtysqskkiaalmkqtatslqkkghlyilgwgtlglvgimdavecvptyqadwrdvr
gfitggyhsienkegdlsslgpqfsishedfvknvlpsvsetdtvlliftldddlnqiek
lvalvkektsniqvichatagqylpnslkktipsiigltwpilfleyegafiqkfqrels
tkwildtvtsgaytlrgkifrnfmvdfkinnsklfhratsvlqrltgqsqqrctevllqs
iygeqtlseqirnttiaghveaaasqdkvlpvaivsllrsctiqdsrsrinsslsirsai
essmnvpgrkrgaedsesr
Download sequence
Identical sequences 3w0l_B 3w0l_D gi|147907178|ref|NP_001083276| gi|37747669|gb|AAH60011| NP_001083276.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]