SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148222411|ref|NP_001088056| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148222411|ref|NP_001088056|
Domain Number 1 Region: 43-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000512
Family Thioltransferase 0.053
Further Details:      
 
Weak hits

Sequence:  gi|148222411|ref|NP_001088056|
Domain Number - Region: 155-213
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0619
Family Tyrosine-dependent oxidoreductases 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148222411|ref|NP_001088056|
Sequence length 329
Comment magnesium transporter protein 1 precursor [Xenopus laevis]
Sequence
MAGLKGLLFGGILFAMCGGLSEGQKKKEMVLSDKVGQLMDWASKRPVIRMNGDKFRRFIK
SPPRNYSVVVMFTALQAHRQCVVCKQADEEYQILANSWRYSSAFTNRIFFAVVDFDEGSD
VFQMLNMNSAPTFINFPPKGKPKKGDTYELQVRGFAAEQLARWVADRTDVNIRVIRPPNY
AGPLMLGLLLAVIGGLVYLRRSNLDFLNNKTGWALAALCFVLAMTSGQMWNHIRGPPYAH
KNPHTNQVNYIHGSSQAQFVAETHIVLLFNGAVTLGMVLLHEAATSDLDVGKRKIMCIAG
ITLVVIFFSWLLSVFRSKYHGYPYSFLMT
Download sequence
Identical sequences Q63ZR0
NP_001088056.1.7800 gi|148222411|ref|NP_001088056| gi|52354699|gb|AAH82850| gi|82180774|sp|Q63ZR0|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]