SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148222876|ref|NP_001083648| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148222876|ref|NP_001083648|
Domain Number 1 Region: 46-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.02e-34
Family PDI-like 0.00025
Further Details:      
 
Domain Number 2 Region: 387-495
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-29
Family PDI-like 0.00053
Further Details:      
 
Domain Number 3 Region: 256-388
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.63e-24
Family PDI-like 0.026
Further Details:      
 
Domain Number 4 Region: 161-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-16
Family PDI-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148222876|ref|NP_001083648|
Sequence length 526
Comment protein disulfide isomerase family A, member 2 [Xenopus laevis]
Sequence
MRWLIFLQFCLLSTFYSSAFGQNDATEEPTKSSSEEETSDELLEEDNVLVLNKRNFNKAL
ETYKYLLVEFYAPWCGHCQELAPKYTKAAEILKDKTEEVRLAKVDGTVETDLSTEFNVNG
YPTLKFFKGGNRTGHIDYGGKRDQDGLVKWMLRRMGPAAVVLDNVESAEKFTSSQEFPVI
GFFKNPEDADIKIFYEVAELQEDFTFALAHDEKLFEKFGVTEDTVIFFKKSEENLNFKPD
EDLGLDKDELSKFLRINSIDLVTEYSAETSDKIFAAQIPNHLLLFINKSDDSQLVLLEHF
RKAAPDFKGKVLFVFIDSNGGYASVLEYFGLKSSDVPTLRFINLESVKKYVFNAPEITED
TIQAFCRSVLEGNVKQNLMSEEIPEDWDKSPVKVLVGKNFEEVAYDETKNVFVEFYAPWC
SHCKEMEPVWEELGEKYKDHENVIIAKIDATANEIDGLRVRGFPNLRFFPAGPERKMIEY
TKERTVELFSAFIDSGGVLPDEQETKEAEAEESKEAAEEDKGKDEL
Download sequence
Identical sequences Q6V4H6
NP_001083648.1.7800 gi|148222876|ref|NP_001083648| gi|38017209|gb|AAR07966|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]