SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148222926|ref|NP_001089335| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148222926|ref|NP_001089335|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.26e-44
Family Glutathione peroxidase-like 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148222926|ref|NP_001089335|
Sequence length 143
Comment hypothetical protein LOC734385 [Xenopus laevis]
Sequence
MSRLQDMYGSRGLQVLAFPCNQFGHQENSGNQEILNILQHVRPGGDFKPNFPLFEKVDVN
GEKEHPLFTFLKQQLPYPSDDSLSLMQDPKSIIWSPVRRNDIAWNFEKFLITKNGVPYKR
YGRRFETFNIQQDIEKLLDEKCA
Download sequence
Identical sequences Q58E16
NP_001089335.1.7800 gi|148222926|ref|NP_001089335| gi|62026275|gb|AAH92112|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]