SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148226947|ref|NP_001080051| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148226947|ref|NP_001080051|
Domain Number 1 Region: 21-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.48e-37
Family PDI-like 0.0013
Further Details:      
 
Domain Number 2 Region: 338-481
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.9e-35
Family PDI-like 0.00023
Further Details:      
 
Domain Number 3 Region: 135-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.77e-19
Family PDI-like 0.0043
Further Details:      
 
Domain Number 4 Region: 236-372
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000723
Family PDI-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148226947|ref|NP_001080051|
Sequence length 502
Comment protein disulfide isomerase family A, member 3 [Xenopus laevis]
Sequence
MNRQLLGAFFLLLAVTAGTQAAGSDVLDLTDDNFESVVAQHSILLVEFFAPWCGHCKKLA
PEYEIAATKLKGTLSLAKVDCTANSNICNKYGVSGYPTLKIFRDGEDSGSYDGPRSADGI
VSTMKKQAGPASVDLRSVEEFEKFVADKDAAVVGFFRDLYSGPHSEFLKAANTLRENYRF
AHTDEKELVDKYDTNGEGVVLFRPPHLANKFEDGSVTFPADEKITSGKIKKFIQDNIFGL
CPHLTQDNKDLIQGKDLLIAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVAN
RKSFGHEVTEFGLDANTGELPVVGIKTAKGEKFVMQEEFSRDGKALERFLQDYFDGKLKR
YMKSESIPESNDGPVKVAVAENFDELVNDESKDVLIEFYAPWCGHCKTLEPKYKELGEKL
ADDPNIVIAKMDATANDVPPQYEVRGFPTIYFAPAGNKQNPKRYEGGREVSEFLSYLKKE
ATNPPVVKEDEKPKKKKKKEEL
Download sequence
Identical sequences Q7ZWU3
gi|148226947|ref|NP_001080051| gi|28302197|gb|AAH46707| NP_001080051.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]