SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148228738|ref|NP_001088468| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148228738|ref|NP_001088468|
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.69e-74
Family BAR domain 0.0000000514
Further Details:      
 
Domain Number 2 Region: 273-347
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148228738|ref|NP_001088468|
Sequence length 351
Comment SH3-domain GRB2-like 3 [Xenopus laevis]
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQP
NPAYRARLGMLNTMSKIRGQVKTTGYPQTEGLLGDCMLRHGRELGEESEFGCALLDGGEC
MKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKKLEGRRLDFDYKKKRQGKIPD
EEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVLVETALDYHRQSAQILEDLHNRL
HNRINTASSRPKRELQHRSIIATLESNEKLHHNGIPSDSPVKLSGSSDPLDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEVVLPLP
Download sequence
Identical sequences Q5U589
NP_001088468.1.7800 gi|148228738|ref|NP_001088468| gi|54311447|gb|AAH84795|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]