SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148233834|ref|NP_001089660| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148233834|ref|NP_001089660|
Domain Number 1 Region: 260-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-82
Family Protein kinases, catalytic subunit 0.000000000327
Further Details:      
 
Domain Number 2 Region: 122-250
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-40
Family SH2 domain 0.00000551
Further Details:      
 
Domain Number 3 Region: 57-153
Classification Level Classification E-value
Superfamily SH3-domain 2.87e-22
Family SH3-domain 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148233834|ref|NP_001089660|
Sequence length 537
Comment hypothetical protein LOC734720 [Xenopus laevis]
Sequence
MGCIKSKEDKGPSIKYRTEPKPDSGSPYGGDPTQATQSPGIKGQAPNFNSHSMTPFGGSS
GITPFGGASSIFAPTPVPYPGGLTGGVTVFVALYDYEARTTEDLSFRKGERFQIINNTEG
DWWEARSIATGKTGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGTFLVRE
SETTKGAYSLSIRDWDEVKGDNVKHYKIRKLDNGGYYITTRAQFESLQKLVKHYSEHADG
LCYRLTTVCPTVKPQTQGLAKDAWEIPRESLRLDLKLGQGCFGEVWIGTWNGTTKVAIKT
LKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEYMTKGSLLDFLKEGDGK
YLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVE
RGYRMPCPQGCPESLHELMKLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences Q498G3
gi|148233834|ref|NP_001089660| gi|71681264|gb|AAI00229| NP_001089660.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]