SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148234401|ref|NP_001086161| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148234401|ref|NP_001086161|
Domain Number 1 Region: 155-270
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.36e-25
Family Glutathione peroxidase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 36-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000218
Family Glutathione peroxidase-like 0.0036
Further Details:      
 
Domain Number 3 Region: 286-412
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000105
Family PDI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148234401|ref|NP_001086161|
Sequence length 414
Comment nucleoredoxin [Xenopus laevis]
Sequence
MSGPGLLVELLGEKLVNSEREEADVQALGSRVSLIGLLFGCGMSAPCLQLLPGLKDFYCK
TRDRLEIVFVSSDPDQKKWQLFVKDMPWLALPYQEKHRKLKLWNKFRISNIPSLIFIEAS
TVKTVCRNGLLLVKDDPEGLEFPWGPKPFCEVIAGPLIRNNSQSQESSTLEGSYVGIYFS
AYWCPPCRSLTRVLVESYRKIKESGQKFEIVLVSADRSEESFKQYFSEMPWLAVPYSDEA
RRSRLNRLYGIQGIPNLIILDPKGEVITRQGRVEVLRDIDCKEFPWHPKPVVELTELNAV
QLNEGPCLVLFVDSEDEGESEAAKQLIQPIAEKIIAQHKAKDEDAPLLFFVAGEDDMTDS
LRDFTNLPEAAPLLTILDMSARAKYVMDVEEITPEIVQSFVTDFLAEKLKPEPI
Download sequence
Identical sequences A0A1L8H859 Q6GM16
gi|148234401|ref|NP_001086161| gi|49256234|gb|AAH74275| gi|82183968|sp|Q6GM16| NP_001086161.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]