SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148235080|ref|NP_001081290| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148235080|ref|NP_001081290|
Domain Number 1 Region: 397-659
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-53
Family YWTD domain 0.00000000358
Further Details:      
 
Domain Number 2 Region: 312-390,660-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.56e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 142-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000694
Family LDL receptor-like module 0.00048
Further Details:      
 
Domain Number 4 Region: 193-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000812
Family LDL receptor-like module 0.00035
Further Details:      
 
Domain Number 5 Region: 25-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 6 Region: 62-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00037
Further Details:      
 
Domain Number 7 Region: 232-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.00021
Further Details:      
 
Domain Number 8 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 9 Region: 273-308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148235080|ref|NP_001081290|
Sequence length 909
Comment low density lipoprotein receptor-1 [Xenopus laevis]
Sequence
MMKPAASFPLLLLGLCHVSAISGIRKCDRNEFQCGDGKCIPYKWICDGSAECKDSSDESP
ETCREVTCGTDQFSCGGRLNRCIPMSWKCDGQTDCENGSDENDCTHKVCADDQFTCRSGK
CISLDFVCDEDLDCDDGSDESYCPAPTCNPAMFQCKDKGICIPKLWACDGDPDCEDGSDE
EHCEGREPIKTDKPCSPLEFHCGSGECIHMSWKCDGGFDCKDKSDEKDCVKPTCRPDQFQ
CNTGTCIHGSRQCDREYDCKDLSDEEGCVNVTKCEGPDVFKCRSGECITMDKVCNKKRDC
RDWSDEPLKECGENECLRNNGGCSHICNDLKIGYECLCNEGYRLVDQKRCEDINECENPN
TCSQICINLVGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSV
IPRLKNVVALDMEIASNKIYWSDLTQRKIYSASMEKADNTSHHETVISNQIQAPDGIAVD
WIHGNIYWTDSKFSTISVANTEGSKRRTPPSDDLEKPRDIVVDPSQGFMYWTDWGLPAKI
EKGGLNGVDRYPLVTENIEWPNGITLDLINQRLYWVDSKLHSLSCIDVTGENRRTVISDE
THLAHPFGLTIFEDLVFWTDIENEAIFSANRLTGRNIMKVAEDLLSPEDIVLYHNLRQPK
AENWCEAHHLGNGGCEYLCLPAPHITARSPKFTCACPDGMHLGDDMRSCVKEPVIPEASP
TTTTSAPVTTTTSAPVTTTTSAPVTTTSTTARPTSRSTTLAKITSTTSTLAPQRPKMAST
TIAPQRPTTNSPKTTLRMITEKVPDHTTQQPMTHSQLADNNFAKAGVVENVRSHPTALYI
VLPIVILCLVAFGGFLVWKNWRLKNTNSINFDNPVYQKTTEEDQVHICRSQDGYTYPSRQ
MVSLEDDIA
Download sequence
Identical sequences Q99087
NP_001081290.1.7800 gi|148235080|ref|NP_001081290| gi|214574|gb|AAA49897| gi|547838|sp|Q99087|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]