SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15321731|gb|AAA49962| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15321731|gb|AAA49962|
Domain Number 1 Region: 252-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-82
Family Protein kinases, catalytic subunit 0.000000000143
Further Details:      
 
Domain Number 2 Region: 142-286
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-38
Family SH2 domain 0.00000173
Further Details:      
 
Domain Number 3 Region: 59-152
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-25
Family SH3-domain 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15321731|gb|AAA49962|
Sequence length 532
Comment pp60c-src protein [Xenopus laevis]
Sequence
MGATKSKPREGGPRSRSLDIVEGSHQPFTSLSASQTPNKSLDSHRPPAQPFGGNCDLTPF
GGINFSDTITSPQRTGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLA
RSLSSGQTGYIPSNYVAPSDSIQAEEWYLGKITRREAERLLLSLENPRGTFLVRESETTK
GAYCLSVSDYDANRGLNVKHYKIRKLDSGGFYITSRTQFISLQQLVAYYSKHADGLCHRL
TTVCPTAKPQTQGLSRDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGT
MSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYISKGSLLDFLKGEMGRYLRLP
QLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQG
AKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRM
PCPPDCPESLHDLMFQCWRKDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences P13115
gi|15321731|gb|AAA49962| gi|21264520|sp|P13115|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]