SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157881381|gb|2BL5_A| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157881381|gb|2BL5_A|
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.08e-36
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157881381|gb|2BL5_A|
Sequence length 140
Comment Chain A, Solution Structure Of The Kh-Qua2 Region Of The Xenopus Star-Gsg Quaking Protein.
Sequence
qlqeklyvpvkeypdfnfvgrilgprgltakqleaetgckimvrgkgsmrdkkkeeqnrg
kpnwehlnedlhvlitvedaqnraelklkraveevkkllvpaaegedslkkmklmelail
ngtyrdanlkspalhhhhhh
Download sequence
Identical sequences 2bl5_A 2bl5A gi|157881381|gb|2BL5_A|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]