SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169642128|gb|AAI60704| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169642128|gb|AAI60704|
Domain Number 1 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-22
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 540-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 18-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000106
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 6 Region: 223-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000783
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 433-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000787
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 193-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000258
Family Classic zinc finger, C2H2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169642128|gb|AAI60704|
Sequence length 602
Comment LOC100158283 protein [Xenopus laevis]
Sequence
MVGLRQGLMDPPINSLTQVAFEDVAVYFSELEWALLKDCQKDLYKTVMRDNYEVVASLGF
PVLRSKALGRMRHGVTVELEGTEEIDIGDSAQNMKDIMKCLNKCLSPLQICTEFSSGCRS
QAVSDPSAKSLGNVKKEEFQTFGALGSLPLRVPNLLANTNSRCDRVALKQGQNGKALSYQ
PDAGAHDAEGFHTPFQCSKCKKTFTNPYDLQSHANVHIREIRYTCRDCGRGFSRSDFFKA
HRHMHMGEKPFKCSECKKCFSAVSILKKHLRSHQPKMSRRAKKMKKKSKQNVPDFLSDLD
YEKKHTCTVCQKTFSKSYNLKVHERIHTGEKPYKCPKCDKCFSQNARLRVHRTTHAEWAH
EAMWVRKRKPSVPTEKLHKCNVCEKSFSKSYSLKVHLRTHTGEKPYTCDECHKSFSKNNL
LTVHKRIHSGERPYQCNDCLKSFSVISHLRVHKRTHTGERPYKCTECIKSFSDYSSMVRH
QRIHSGAKPYQCNVCQKTFREKSHVTVHQRTHTGERPYKCAECSKTFSDCSSFVEHRRHH
TGARPYKCELCHKSFTKAYTLKIHHRVHTGERPYQCDQCPRSFSINYHLKVHEKTHWNNQ
KL
Download sequence
Identical sequences B1H1R1
NP_001121212.1.7800 gi|169642128|gb|AAI60704| gi|189217480|ref|NP_001121212|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]