SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169642542|gb|AAI60674| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169642542|gb|AAI60674|
Domain Number 1 Region: 258-412
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.99e-60
Family Glutathione S-transferase (GST), C-terminal domain 0.000000449
Further Details:      
 
Domain Number 2 Region: 145-252
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.92e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169642542|gb|AAI60674|
Sequence length 419
Comment LOC100037123 protein [Xenopus laevis]
Sequence
AAYRAGVIGAGSWRLVVPQRMTGVVMGAAGTGRCLSFLGVSGGGSGLGVRAYMSQLGAPA
SHLVHRAAERSSLPLAKATYPAVRGYRTGGWWRESDRSSRKVLGLVFVLGGSLGVFQALK
SSLGEQRAEEKQQQQQQAEDGSFRLTLYQYKTCPFCSKVRAFLDYYRLPHEIVEVNPVMR
GEIKFSSYRKVPILIADSGSSLQLNDSSVIISVMKSFLTSNKSLEEILSYYPSMKAVNDK
GKEVVEYNNKYWLMLDERETERIYPTKESRVEEMKWRRWADDWLVHLISPNVYRTPHEAL
ASFDYIVREGNFGTVEGLFAKYVGAVAMFIIGKRLKSRHHLQDNVRQDLYSAANDWVAAV
GKHRKFMGGSQPNLADLAVYGVLRVMEGLESFNDMMNNTKIKPWYERMATAVYSPVDSQ
Download sequence
Identical sequences B1H1N3
gi|169642542|gb|AAI60674|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]