SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|1708831|sp|P37137| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|1708831|sp|P37137|
Domain Number 1 Region: 165-239
Classification Level Classification E-value
Superfamily Homeodomain-like 2.18e-20
Family Homeodomain 0.0016
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.21e-16
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000304
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|1708831|sp|P37137|
Domain Number - Region: 92-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0149
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|1708831|sp|P37137|
Sequence length 402
Comment RecName: Full=LIM/homeobox protein Lhx5; Short=LIM homeobox protein 5; AltName: Full=Homeobox protein LIM-5; Short=xLIM-5; AltName: Full=xLIM-2A
Sequence
MMAHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKTDFFRRF
GTKCAGCSLGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYI
SASSLKESSLNSVSSCTDRSLSPDIQDPIQDESKETDHSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFIATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEILSSGPYSYYGDYQGDYYGSGNYDFFPHGPP
SSQTQSPADSSYLQNSGPGSTPLGPLESQLSGHHPSENQRYVDMISHPDTPSPEPGMTGP
LHPISGEVFTGGPSPPFSMSNNSGFSGPLPHQNLDINEATVW
Download sequence
Identical sequences P37137
gi|147902022|ref|NP_001084038| gi|1708831|sp|P37137| gi|54311470|gb|AAH84744| gi|840658|gb|AAA99464| NP_001084038.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]