SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190358766|sp|Q6GP98| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190358766|sp|Q6GP98|
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.5e-39
Family Selenoprotein W-related 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190358766|sp|Q6GP98|
Sequence length 136
Comment RecName: Full=Selenoprotein M; Short=SelM; Flags: Precursor
Sequence
MWLPLPLLLGLLQLQPILSYQIDWNKLERINRGKVESCGGUQLNRLKEVKGFVTEDLPLY
HNLEMKHIPGADPELVLITSRYEELERIPLSDMKRDEINQLLKDLGFYRKSSPDAPVPAE
FKMAPARASGDTKEDL
Download sequence
Identical sequences Q6GP98
gi|190358766|sp|Q6GP98| gi|212274308|ref|NP_001085717| NP_001085717.2.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]