SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213623804|gb|AAI70242| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213623804|gb|AAI70242|
Domain Number 1 Region: 210-481
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-79
Family Protein kinases, catalytic subunit 0.00000000112
Further Details:      
 
Domain Number 2 Region: 100-242
Classification Level Classification E-value
Superfamily SH2 domain 1.2e-38
Family SH2 domain 0.00000855
Further Details:      
 
Domain Number 3 Region: 41-124
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-21
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|213623804|gb|AAI70242|
Sequence length 488
Comment V-yes-1 Yamaguchi sarcoma viral related oncogene homolog [Xenopus laevis]
Sequence
MGCIKSKTDNPRDAMGKNNPASRTPSLLPGQKMIQDIEEQGNIVIALYPYQGIHEDDLSF
KKGEKLKVLEEHGEWWKAKSLSTKKEGFIPSNYVARVNTLETEEWFFKDLTRKDAERQLL
APGNNPGAFLIRESETSKGSYSLSIRDCDPQTGDVIKHYKIRTLDNGGYYISPRITFTSI
NEMIQHYQKQADGLCRKLDKPCFSPKPQKPWDKDAWEIPRESIKMVRKLGAGQFGEVWMG
FYNNSTKVAVKTLKPGSMSVQAFMEEANLMKTLQHDKLVRLYAVVSKEEPIYIITEYMAK
GSLLDFLKSDEGGKVILPKSIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIA
DFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITFGKIPY
PGMSNSDVMSALQRGYRMPRMENCPEELYDIMKQCWKEKAEERPTFDYLQSVLDDFYTAT
ETQYQQQP
Download sequence
Identical sequences O13064
gi|147903887|ref|NP_001079115| gi|2114076|gb|BAA20078| gi|213623804|gb|AAI70242| NP_001079115.1.7800 XP_018121678.1.7800 XP_018121679.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]