SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|213625398|gb|AAI70523| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213625398|gb|AAI70523|
Domain Number 1 Region: 397-659
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-54
Family YWTD domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 312-390,660-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000108
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000838
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 4 Region: 142-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000929
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 5 Region: 193-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000102
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 6 Region: 62-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00032
Further Details:      
 
Domain Number 7 Region: 232-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 8 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 9 Region: 273-308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213625398|gb|AAI70523|
Sequence length 892
Comment Ldlr2-a protein [Xenopus laevis]
Sequence
MMKPAVSFPLLLLGLCHVSAFSGIGKCDRNEFQCGDGKCIPYKWICDGSAECKDGSDESS
ETCRAVTCGADQFSCGGRLNRCIPLFWKCDGQTDCENGSDENDCTRKVCADDQFTCRSGK
CISLDFVCDEDQDCDDGSDESYCPAPTCNPAMFQCKDKGICIPKLWACDGDRDCEDGSDE
EHCEGREPIKTDKPCAPLEFHCGSGECIHMSWKCDGGYDCKDKSDEKDCVKPTCRPDQFQ
CNDGTCIHGSRQCDREYDCKDLSDEEGCVNVTKCEGPDVFKCRSGECITMDKVCDKKRDC
RDWTDEPIKECGENECLRNNGGCSHICNDLKIGYECLCNEGYRLVDQKRCEDLNECENPN
TCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSF
IPRLKNVVALDMEIASNKIYWSDLTQRKIYSASMDKADNTSHHETVISNQIQAPDGIAVD
WIHGNIYWTDSKFSTISVANTEGSKRKTLFTDDLAKPRDIVVDPSQGFMYWTDWGLPAKI
EKGGLNGVDRYPLVTDNIEWPNGITLDLISQRLYWVDSKLHSLSCIDITGENRRTVLSDE
THLAHPFGLTIFEDLVFWTDIENEAIFSANRLTGENIMKVAEDLLSPEDIVLYHNLRQPK
AENWCESHHLGNGGCEYLCLPAPHVNARSPKFTCACPDGMHLGTDMRNCMKEPVTQEATT
STTTSAPVTTTSTARPSSRITTLAKIASTTSTLAPQRPKMVSTTVPPPRPTTNSPKTTLR
MNTEKVPAHTTQEPMTHSQLAGNKFAEAGVVESARSHPTALYIVLPIVILCLVSFGGFLL
WKNWRLKNTNSINFDNPVYQKTTEEDQVHICRSQDGYTYPSRQMVSLEDDIA
Download sequence
Identical sequences B7ZSH2
gi|213625398|gb|AAI70523| gi|213626297|gb|AAI70522|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]