SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213626955|gb|AAI70466| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213626955|gb|AAI70466|
Domain Number 1 Region: 1124-1319
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.00002
Further Details:      
 
Domain Number 2 Region: 910-1033
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-29
Family Pleckstrin-homology domain (PH domain) 0.0000105
Further Details:      
 
Domain Number 3 Region: 38-65,93-165
Classification Level Classification E-value
Superfamily PDZ domain-like 3.25e-19
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213626955|gb|AAI70466|
Sequence length 1927
Comment Arhgap21 protein [Xenopus laevis]
Sequence
MATRRAIVPEQQQQEPSSPASEISKNKDGQEQSEMVSPMEEEGFCWPGPKSVALRRTSDG
FGFTLRHFIVYPPESAVHTSIKDEENGNRGVNAGRPRNKLEPMDTIFVKQVKEGGPAHEA
GLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSTLELSVMPKDEDILQLAYSQDAYLKGN
DSYSGNAHHIPEPPPLCYPRIKPAASVMAQPVEVPPSGTSLAKQQSSRPMKTATTQPDRS
YRVEIQVPPSPTDLVKSNTAVCVCNEAVRTVLVPSEKVVDLSSNRTNRAGPLHRTEDVRY
GLADPSILKRTTSPTSSIPHVQMVPTARQFDNAGVIGKPPSYGGHAENMFSTRPTAQAEG
SPSPTNHYSSPGPHQQIDWRNYKTYKEYIDNRRMQMYGCRTIQERLDSLKAASQTTTDYN
QMLPNHFSGQSRRRSTSHDRVQQSVQMRQRSFSQERLEDPVLMKEWPRSASQDTLSSAVA
SRNHRSESWDYHARKGDFDQFIVETQSNGERKHNYKWSGFTEQDDRRGITERPRQHSFHM
SLRSPNFTMAPVPYTSFAHPLQKVHPDVKTIQPTRQNSYRSPHPRPAVSDRSGFAVSKSN
SVKIPTPCASKSYSPSVRSDDGIVRDQKPVNYMHVSGPQNFQRKTQTESASGFQLDSVKT
SMSASSSPPANTKPAKQVKHSTATSQNVDVKKTPSPEANAGDSDAVLTPVDQVVLREKPS
PGQQTSPPIRQQSYIFAVNEQEGVSDTTCWLPNDARREVHIKRIEQRKASGSNSPGNSLA
SIPFIDEPTSPSIDHEIGNIPASAVISISEQPLPTITTVPPSPTSPVPLMRRHFSHDHDS
IRPSILEVNSKTERSKSCDEGLDDYKEEGKLGLKQGSSLKGVQARENVPSSEDSESRKDS
SSDVFSDSNKEGFLYFRQVTTEKGKRVSGSIRPWKQMYVVLRGSALYLQKDKKEQTGHSS
AQSDEEQLIGINGCLIDISYSETKRKHVFRLTTSDREFLFQAEDRDDMLAWIKAIQENGN
LNDEQTDQASRVLISKRIKEYNTMMSSASNKSEQSPKAPRQTLSIRQPFRATRPDGKLQS
PHSPKQESERRLFSKDDISPPKDKGSWRRIMKNPFEKKPITGGTFGVRLDDCPPAHNNKY
VPLIVDVCCKLVEERGLEATGIYRVPGNNAAISSMQEDLNKANTDIDIQDDKWRDLNVIS
SLLKSFFRKLPDPLFTNEKYNDFIEANRTEDPVERLKTLKRLILDLPDHHYETLKYLSAH
LKTVADNAELNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQKHDWFFS
DESADEPITTVHEESTVESQPVPNIDHLLPNIGRTGLSPGDVSDSATSDSAKPKGSWGSG
KDQYSRELLVSSLFAAASRKRKKPKDKPQPSSSEDELDNVFYQKELSQVEFQIPDKQNVD
KDADLKAKANALSFKDADNIKGTNIITEDKLESDIMHSESTSPCLPKLLEPPKENHRLQV
PSDDKTIPQISFQMEESMSDSGTMLSNSSQASAQRSKPKVVSPEFKGHDFLTADVSSITS
DYSTTSSTIYMTGLDPNPISPEVQSVAESKGEEADDERSELISEGRPVETDSENDFHIFA
SSLAFNRQHRSKEEDPPRNVQANAEGSPSCTEGSITPRLDTRRFSSHKLIECDTLSRKKS
VRLKTDSECSAESKNEETLSDAHEVMKKSRSPINVDTTANNEPEEPAWRIKITDRLKLRL
KASADDMFGIGSQKAHAAETRKKKNIRRRHTLGGQRDFAEISVLNAWKINEPSSKEVELS
AVDRLKPKCPSQDLSISDWLARERLRTSTSELSTVEPEEKHISETTGQKESVSPSPPPSS
SPSQVSTANIPTGSESPSLGTAPQSDDQMNGDSFQSKNKNNFSPAVDAHPHKLSGTQVVR
SRFYQYL
Download sequence
Identical sequences B7ZSB8
gi|213626955|gb|AAI70466|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]