SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|232034|sp|P30151| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|232034|sp|P30151|
Domain Number 1 Region: 139-227
Classification Level Classification E-value
Superfamily eEF-1beta-like 5.89e-36
Family eEF-1beta-like 0.00000452
Further Details:      
 
Domain Number 2 Region: 8-66
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000209
Family Glutathione S-transferase (GST), C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|232034|sp|P30151|
Sequence length 227
Comment RecName: Full=Elongation factor 1-beta; Short=EF-1-beta; AltName: Full=p30
Sequence
MGFGDLKSPAGLKVLKEFLADKSYIEGYVPSQADVAVFDALSAAPPADLFHALRWYNHIK
SYEKQKSSLPGVKKALGNYGPVNIEDTTGSAAKETKEEDDDDIDLFGSDDEEESEDAKRV
RDERLAQYEAKKSKKPTLIAKSSILLDVKPWDDETDMGKLEECLRSIQMDGLLWGSSKLV
PVGYGIKKLQIQCVVEDDKVGTDVLEEKITAFEDFVQSMDVAAFNKI
Download sequence
Identical sequences P30151
NP_001084134.1.7800 gi|148229058|ref|NP_001084134| gi|232034|sp|P30151| gi|64662|gb|CAA49418|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]